PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sme2.5_03336.1_g00003.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family ARF
Protein Properties Length: 609aa    MW: 68001 Da    PI: 6.8932
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sme2.5_03336.1_g00003.1genomeEGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B374.41.4e-23114214198
                              EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-E CS
                       B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDf 79 
                              f k+lt+sd+++ g +++pk +a+++       g+++ +  tl  +d +g+ W++++iyr++++r++lt+GW+ Fv++++L +gD+
  Sme2.5_03336.1_g00003.1 114 FAKTLTQSDANNGGGFSVPKYCADTIfpsldysGNPPVQ--TLLAKDVHGKIWSFRHIYRGTPERHLLTTGWSTFVNEKKLVAGDS 197
                              89*********************999******6555555..8999***************************************** PP

                              EEEEE-SSSEE..EEEEE- CS
                       B3  80 vvFkldgrsefelvvkvfr 98 
                              +vF   +++++e +v+++r
  Sme2.5_03336.1_g00003.1 198 IVFV--RDENEEIFVGIRR 214
                              ****..55788889***98 PP

2Auxin_resp103.13.4e-34274356183
               Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                              aa+ a+++ +Fev+++Pr+st+eF v++++v++al+++++ GmRfkm feteds    ++Gt+ +v+++dp+rWp+S+Wr L+
  Sme2.5_03336.1_g00003.1 274 AANLAANRHPFEVTFYPRTSTPEFFVQASRVKAALQIPWCSGMRFKMPFETEDSVISWFMGTICSVQAADPTRWPDSPWRILQ 356
                              7899**************************************************99999**********************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.40.330.102.2E-35108217IPR015300DNA-binding pseudobarrel domain
SuperFamilySSF1019363.66E-29109216IPR015300DNA-binding pseudobarrel domain
CDDcd100175.06E-20114214No hitNo description
PROSITE profilePS5086312.971114216IPR003340B3 DNA binding domain
PfamPF023621.4E-21114214IPR003340B3 DNA binding domain
SMARTSM010192.3E-21114216IPR003340B3 DNA binding domain
PfamPF065071.1E-29274356IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009725Biological Processresponse to hormone
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 609 aa     Download sequence    Send to blast
MESMENVREE NCLDSQLWHA FAGTVVKMPA VNSIVFYFPQ GHLEQEGVSV EFRSEIRIPS  60
YIPCRVSGIK YMAEGETDEV YAKISLKPVS PNELFEVADD GIGVKIGSDK PLAFAKTLTQ  120
SDANNGGGFS VPKYCADTIF PSLDYSGNPP VQTLLAKDVH GKIWSFRHIY RGTPERHLLT  180
TGWSTFVNEK KLVAGDSIVF VRDENEEIFV GIRRVKKKGL SGGPETSPWW IPPVGRFSIP  240
QGGFSAFLKN DENTNSSWKL MNKGKMKAES VIEAANLAAN RHPFEVTFYP RTSTPEFFVQ  300
ASRVKAALQI PWCSGMRFKM PFETEDSVIS WFMGTICSVQ AADPTRWPDS PWRILQVTWD  360
EPNLLQNVTC VNPWLVELVS NMPTIHFNPC TRPLKKLRLS DQSDVPLDGH LPTTGFPRDH  420
VDFPPDANLP MLSFPDKHLL RPNIGPFHCL PNDTPVGIQG ARHAPYSLSL PNLHSNRLHP  480
CLFPDNIPSL HRATPSTSNN TKISKSNSND DVSCLLALGS STQTAEKVHR KKAPQFVLFG  540
QPIVIEQQTS PNNPENSVSH VRATNSFSNG SESKKENISE MLNNVTYRDI IDAVKQHGDE  600
PFRDFTNIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A3e-86137734388Auxin response factor 5
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006363667.10.0PREDICTED: auxin response factor 18-like
SwissprotQ653H70.0ARFR_ORYSJ; Auxin response factor 18
TrEMBLK4D4470.0K4D447_SOLLC; Auxin response factor
STRINGSolyc10g086130.1.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA59224115
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30080.11e-168auxin response factor 16